PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010925972.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 351aa    MW: 38427.1 Da    PI: 8.3146
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010925972.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-55151431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv +++++  ++i+e+d++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+
  XP_010925972.1  15 LPPGFRFHPTDEELITYYLLKKVLDSSFTG-RAIAEIDLNKCEPWELPEKAKMGEKEWYFFSLRDRKYPTGLRTNRATDAGYWKATGKDREIYSS 108
                     79*************************999.89***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++ lvg+kktLvfykgrapkg+k++Wvmheyrle
  XP_010925972.1 109 rTHYLVGMKKTLVFYKGRAPKGQKSNWVMHEYRLE 143
                     55567****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6312167IPR003441NAC domain
PROSITE profilePS5100560.14315167IPR003441NAC domain
PfamPF023651.8E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MESYGHHFDN SESQLPPGFR FHPTDEELIT YYLLKKVLDS SFTGRAIAEI DLNKCEPWEL  60
PEKAKMGEKE WYFFSLRDRK YPTGLRTNRA TDAGYWKATG KDREIYSSRT HYLVGMKKTL  120
VFYKGRAPKG QKSNWVMHEY RLEGKFAYHF LSRSSKDEWV ISRVFQKSGG SKKGRVGLTG  180
THFFDSAGGS TSAASLPPLL DSSPYGATAA AAAAAAGDRE SCSYESSERE PVPCFSTVAT  240
ATTGLTHHHL PALPALTAYG RIPAGGGAGS VFPSLRSLQE SLHLPFFLST LAPSVGGSAA  300
AMGWDAPVHH RGGEEMGGNG WPSDLDRKAE VAGRTHPMAV GSTELDCLWT F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-521117316174NAC domain-containing protein 19
3swm_B1e-521117316174NAC domain-containing protein 19
3swm_C1e-521117316174NAC domain-containing protein 19
3swm_D1e-521117316174NAC domain-containing protein 19
3swp_A1e-521117316174NAC domain-containing protein 19
3swp_B1e-521117316174NAC domain-containing protein 19
3swp_C1e-521117316174NAC domain-containing protein 19
3swp_D1e-521117316174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010925972.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040171e-104NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLF2WAC50.0F2WAC5_ELAGV; No apical meristem-related protein
TrEMBLF2WAC70.0F2WAC7_PHODC; No apical meristem-related protein
STRINGGSMUA_Achr10P22350_0011e-152(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99403543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-100NAC family protein